CacheBy
Atlas Antibodies Anti-NCAPH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCAPH2 Antibody

상품 한눈에 보기

Human NCAPH2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Affinity purification 방식으로 정제되었으며, 40% glycerol 기반 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067932-100 Anti-NCAPH2 Antibody, non-SMC condensin II complex, subunit H2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067932-25 Anti-NCAPH2 Antibody, non-SMC condensin II complex, subunit H2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCAPH2 Antibody

Anti-NCAPH2 Antibody

Target: non-SMC condensin II complex, subunit H2
Supplier: Atlas Antibodies


  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NCAPH2.

Alternative Gene Names

384D8-2, CAP-H2, hCAP-H2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein non-SMC condensin II complex, subunit H2
Target Gene NCAPH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000008690 (70%), Rat ENSRNOG00000009598 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.