Atlas Antibodies Anti-NCBP1 Antibody
Atlas Antibodies

Atlas Antibodies Anti-NCBP1 Antibody

✦상품 한눈에 보기

인간 NCBP1 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용 가능. 정제된 PrEST 항원 기반 친화 정제. 인간, 마우스, 랫트에 높은 반응성. 안정한 PBS-글리세롤 버퍼에 보존.

브랜드: Atlas Antibodies
카테고리 상품 전체보기브랜드 상품 전체보기
#Antibodies#Atlas Antibodies

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

소모품
HPA049031-100
Atlas Antibodies HPA049031-100 Anti-NCBP1 Antibody, nuclear cap binding protein subunit 1, 80kDa 100ul
CAS: -단위: 100ul
재고문의재고: -
728,000원
(VAT포함)800,800원
HPA049031-25
Atlas Antibodies HPA049031-25 Anti-NCBP1 Antibody, nuclear cap binding protein subunit 1, 80kDa 25ul
CAS: -단위: 25ul
재고문의재고: -
528,000원
(VAT포함)580,800원
소모품
HPA049031-100
재고문의재고: -
Atlas Antibodies HPA049031-100 Anti-NCBP1 Antibody, nuclear cap binding protein subunit 1, 80kDa 100ul
CAS: -단위: 100ul
728,000원
(VAT포함)800,800원
HPA049031-25
재고문의재고: -
Atlas Antibodies HPA049031-25 Anti-NCBP1 Antibody, nuclear cap binding protein subunit 1, 80kDa 25ul
CAS: -단위: 25ul
528,000원
(VAT포함)580,800원

✨AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Anti-NCBP1 Antibody

Target: Nuclear cap binding protein subunit 1 (80 kDa)
Supplier: Atlas Antibodies

  • IHC (Orthogonal Validation):
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Independent Validation):
    Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.

  • ICC (Immunocytochemistry):
    Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human NCBP1.

Alternative Gene Names

CBP80, NCBP, Sto1

Target Information

항목 내용
Target Protein Nuclear cap binding protein subunit 1, 80kDa
Target Gene NCBP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (98%), Rat (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit

Antigen Sequence

FVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPH

Buffer Information

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

🏷️Atlas Antibodies 상품 둘러보기

동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies Anti-NCAPH2 Antibody

Atlas Antibodies

Atlas Antibodies Anti-NCAPH2 Antibody

528,000원

Atlas Antibodies Anti-NCAPD2 Antibody

Atlas Antibodies

Atlas Antibodies Anti-NCAPD2 Antibody

528,000원

Atlas Antibodies Anti-NCBP1 Antibody

Atlas Antibodies

Atlas Antibodies Anti-NCBP1 Antibody

528,000원

Atlas Antibodies Anti-NCAPH Antibody

Atlas Antibodies

Atlas Antibodies Anti-NCAPH Antibody

528,000원

Atlas Antibodies Anti-NCAPG2 Antibody

Atlas Antibodies

Atlas Antibodies Anti-NCAPG2 Antibody

528,000원

배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0