Atlas Antibodies Anti-NCBP1 Antibody

Anti-NCBP1 Antibody

Target: Nuclear cap binding protein subunit 1 (80 kDa)
Supplier: Atlas Antibodies

Recommended Applications

• IHC (Orthogonal Validation):
  Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

• WB (Independent Validation):
  Validation of protein expression in Western Blot by comparing independent antibodies targeting different epitopes of the protein.

• ICC (Immunocytochemistry):
  Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human NCBP1.

Alternative Gene Names

CBP80, NCBP, Sto1

Target Information

Antigen Sequence

FVSVTQEEDVPQVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPH

Buffer Information

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지