Thermo Fisher Scientific REEP1 Polyclonal Antibody
Human, Mouse, Rat에 반응하는 REEP1 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot과 ELISA에 적합하며, 고순도의 Affinity Chromatography 정제 제품. PBS/glycerol buffer에 보관하며 연구용으로 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101–201 of human REEP1 (NP_075063.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.36 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2914717 |
Product Specific Information
Positive test controls include:
- Mouse brain
- Mouse spinal cord
- Rat brain
Subcellular localization: Endoplasmic reticulum, Membrane, Mitochondrion membrane, Multi-pass membrane protein
Immunogen sequence:
KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSSF MQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
Target Information
REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CHD1 Polyclonal Antibody
710,700원
Thermo Fisher Scientific
Thermo Fisher Scientific GLYCTK Polyclonal Antibody
710,700원
Thermo Fisher Scientific
Thermo Fisher Scientific REEP1 Polyclonal Antibody
710,700원
Thermo Fisher Scientific
Thermo Fisher Scientific AES Polyclonal Antibody
710,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Aconitase 1 Polyclonal Antibody
710,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|