원본
Thermo Fisher Scientific REEP1 Polyclonal Antibody
상품 한눈에 보기
Human, Mouse, Rat에 반응하는 REEP1 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot과 ELISA에 적합하며, 고순도의 Affinity Chromatography 정제 제품. PBS/glycerol buffer에 보관하며 연구용으로 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 11:03
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5121145 REEP1 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
710,700원VAT 포함 781,770원
Thermo Fisher Scientific · Thermo Fisher Scientific REEP1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101–201 of human REEP1 (NP_075063.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.36 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2914717 |
Product Specific Information
Positive test controls include:
- Mouse brain
- Mouse spinal cord
- Rat brain
Subcellular localization: Endoplasmic reticulum, Membrane, Mitochondrion membrane, Multi-pass membrane protein
Immunogen sequence:
KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSSF MQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
Target Information
REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific CHD1 Polyclonal Antibody710,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific GLYCTK Polyclonal Antibody710,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific AES Polyclonal Antibody710,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Aconitase 1 Polyclonal Antibody710,700원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.