원본
Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
상품 한눈에 보기
CFL2 단백질을 인식하는 Mouse IgG2b 단일클론 항체로 Western blot, IHC, ICC, Flow cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 동결건조 형태로 제공되며, 장기 보관 시 -20°C 권장. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 27. 오전 10:44
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA536233 CFL2 Monoclonal Antibody (8C13) 100 ug pk판매 단위 pk
재고 1개
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 8C13 |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121–153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884067 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific ATP5H Monoclonal Antibody (6B12)680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific COPE Monoclonal Antibody (9B6)680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HSPH1 Monoclonal Antibody (3D10)680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PDCD6IP Monoclonal Antibody (14D10)680,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.