Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
CFL2 단백질을 인식하는 Mouse IgG2b 단일클론 항체로 Western blot, IHC, ICC, Flow cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 동결건조 형태로 제공되며, 장기 보관 시 -20°C 권장. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 8C13 |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2/CFL2 (121–153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884067 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ATP5H Monoclonal Antibody (6B12)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific COPE Monoclonal Antibody (9B6)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific CFL2 Monoclonal Antibody (8C13)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPH1 Monoclonal Antibody (3D10)
680,400원
Thermo Fisher Scientific
Thermo Fisher Scientific PDCD6IP Monoclonal Antibody (14D10)
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|