Thermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)
CCT3 단백질을 표적으로 하는 Mouse IgG1 단클론 항체로, Western blot 및 Immunocytochemistry에 적합. Lyophilized 형태로 제공되며, 재구성 시 500 µg/mL 농도. 인간 단백질에 반응하며 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 2 publications |
| Immunocytochemistry (ICC/IF) | 5 µg/mL | View publications |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 12H4 |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497–536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2744928 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC).
This complex consists of two identical stacked rings, each containing eight different proteins.
Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner.
The complex folds various proteins, including actin and tubulin.
Alternate transcriptional splice variants have been characterized for this gene.
In addition, a pseudogene of this gene has been found on chromosome 8.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.