Thermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)
CCT3 단백질을 표적으로 하는 Mouse IgG1 단클론 항체로, Western blot 및 Immunocytochemistry에 적합. Lyophilized 형태로 제공되며, 재구성 시 500 µg/mL 농도. 인간 단백질에 반응하며 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 2 publications |
| Immunocytochemistry (ICC/IF) | 5 µg/mL | View publications |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 12H4 |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497–536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2744928 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC).
This complex consists of two identical stacked rings, each containing eight different proteins.
Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner.
The complex folds various proteins, including actin and tubulin.
Alternate transcriptional splice variants have been characterized for this gene.
In addition, a pseudogene of this gene has been found on chromosome 8.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Emerin Monoclonal Antibody (5A10)
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Influenza A H5N1 HA Antibody Cocktail
731,200원
Thermo Fisher Scientific
Thermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ZFP57 Monoclonal Antibody (GT865)
731,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Cre recombinase Monoclonal Antibody (GT10212)
731,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|