원본
Thermo Fisher Scientific Emerin Monoclonal Antibody (5A10)
상품 한눈에 보기
Emerin 단백질을 인식하는 Mouse IgG1 단클론 항체로, Western blot, IHC, ICC, Flow cytometry에 사용 가능. 인간 시료에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도.
- 카탈로그번호
- MA527874
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 08:05
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA527874 Emerin Monoclonal Antibody (5A10) 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Emerin Monoclonal Antibody (5A10)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 5A10 |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1–48 aa: MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2744930 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Emerin is a nuclear membrane protein associated with the inner nuclear membrane and is involved in nuclear structure and gene regulation. Mutations in the Emerin gene are linked to Emery-Dreifuss muscular dystrophy. This antibody targets the N-terminal region of human Emerin.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific FABP3 Monoclonal Antibody (6C4)568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Cystatin B Monoclonal Antibody (2B6)568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Influenza A H5N1 HA Antibody Cocktail731,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.