Thermo Fisher Scientific Emerin Monoclonal Antibody (5A10)
Emerin 단백질을 인식하는 Mouse IgG1 단클론 항체로, Western blot, IHC, ICC, Flow cytometry에 사용 가능. 인간 시료에 반응하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 5A10 |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1–48 aa: MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2744930 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Emerin is a nuclear membrane protein associated with the inner nuclear membrane and is involved in nuclear structure and gene regulation. Mutations in the Emerin gene are linked to Emery-Dreifuss muscular dystrophy. This antibody targets the N-terminal region of human Emerin.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FABP3 Monoclonal Antibody (6C4)
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Cystatin B Monoclonal Antibody (2B6)
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Emerin Monoclonal Antibody (5A10)
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Influenza A H5N1 HA Antibody Cocktail
731,200원
Thermo Fisher Scientific
Thermo Fisher Scientific CCT3 Monoclonal Antibody (12H4)
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|