
Atlas Antibodies Anti-MYBL2 Antibody
Human MYBL2 단백질을 인식하는 토끼 폴리클로날 항체. B-MYB/BMYB 유전자에 대응하며, ICC 등 면역학적 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 휴먼 반응성 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYBL2 Antibody
Target: v-myb avian myeloblastosis viral oncogene homolog-like 2 (MYBL2)
Type: Polyclonal Antibody against Human MYBL2
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human MYBL2 (v-myb avian myeloblastosis viral oncogene homolog-like 2).
Alternative gene names: B-MYB, BMYB
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LQASHQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000007805 | 84% |
| Mouse | ENSMUSG00000017861 | 82% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MYADML2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBPC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|