Atlas Antibodies Anti-MYBL2 Antibody

상품 한눈에 보기

Human MYBL2 단백질을 인식하는 토끼 폴리클로날 항체. B-MYB/BMYB 유전자에 대응하며, ICC 등 면역학적 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 휴먼 반응성 검증 완료.

카탈로그번호: HPA055416-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055416-100 Anti-MYBL2 Antibody, v-myb avian myeloblastosis viral oncogene homolog-like 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055416-25 Anti-MYBL2 Antibody, v-myb avian myeloblastosis viral oncogene homolog-like 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYBL2 Antibody

Anti-MYBL2 Antibody

Target: v-myb avian myeloblastosis viral oncogene homolog-like 2 (MYBL2)
Type: Polyclonal Antibody against Human MYBL2
Supplier: Atlas Antibodies

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human MYBL2 (v-myb avian myeloblastosis viral oncogene homolog-like 2).
Alternative gene names: B-MYB, BMYB

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
LQASHQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPF

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Identity
Rat	ENSRNOG00000007805	84%
Mouse	ENSMUSG00000017861	82%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand