Atlas Antibodies Anti-MYBPC1 Antibody

상품 한눈에 보기

Human MYBPC1 단백질을 인식하는 rabbit polyclonal antibody. IHC 등에서 Orthogonal validation으로 검증됨. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존되어 안정적임.

카탈로그번호: HPA027614-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027614-100 Anti-MYBPC1 Antibody, myosin binding protein C, slow type 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027614-25 Anti-MYBPC1 Antibody, myosin binding protein C, slow type 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MYBPC1 Antibody

Anti-MYBPC1 Antibody

Target: myosin binding protein C, slow type (MYBPC1)
Type: Polyclonal Antibody against Human MYBPC1

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit against human MYBPC1.
Validated using orthogonal IHC and RNA-seq expression data.

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	myosin binding protein C, slow type
Target Gene	MYBPC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000056493 (86%), Mouse ENSMUSG00000020061 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet