
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MYBPC1 Antibody
상품 한눈에 보기
Human MYBPC1 단백질을 인식하는 rabbit polyclonal antibody. IHC 등에서 Orthogonal validation으로 검증됨. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존되어 안정적임.
- 카탈로그번호
- HPA027614-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027614-100 Anti-MYBPC1 Antibody, myosin binding protein C, slow type 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027614-25 Anti-MYBPC1 Antibody, myosin binding protein C, slow type 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MYBPC1 Antibody
Anti-MYBPC1 Antibody
Target: myosin binding protein C, slow type (MYBPC1)
Type: Polyclonal Antibody against Human MYBPC1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human MYBPC1.
Validated using orthogonal IHC and RNA-seq expression data.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myosin binding protein C, slow type |
| Target Gene | MYBPC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000056493 (86%), Mouse ENSMUSG00000020061 (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



