
Atlas Antibodies Anti-MYBPC1 Antibody
상품 한눈에 보기
Human MYBPC1 단백질을 표적으로 하는 고품질 Rabbit Polyclonal Antibody. IHC orthogonal validation을 통해 단백질 발현 검증. PrEST 항원으로 친화 정제된 고특이 항체로 다양한 조직 연구에 적합. PBS/glycerol buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYBPC1 Antibody
myosin binding protein C, slow type
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human MYBPC1
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myosin binding protein C, slow type |
| Target Gene | MYBPC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000056493 (86%), Mouse ENSMUSG00000020061 (85%) |
Antigen Sequence:
DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MYBPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBPC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYBBP1A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.