
Atlas Antibodies Anti-MTRF1L Antibody
상품 한눈에 보기
Human MTRF1L 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. 사람에 특이적으로 반응하며, Mouse 및 Rat과 높은 서열 유사성을 가짐. 40% glycerol 기반 PBS buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTRF1L Antibody
Target: mitochondrial translational release factor 1-like (MTRF1L)
Type: Polyclonal Antibody against Human MTRF1L
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against Human MTRF1L.
Affinity purified using the PrEST antigen as affinity ligand.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial translational release factor 1-like |
| Target Gene | MTRF1L |
| Antigen Sequence | KELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000019774 (82%), Rat ENSRNOG00000018773 (80%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MTSS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRF1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTPAP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.