
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTRF1L Antibody
상품 한눈에 보기
Human MTRF1L 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. 사람에 특이적으로 반응하며, Mouse 및 Rat과 높은 서열 유사성을 가짐. 40% glycerol 기반 PBS buffer에 보존됨.
- 카탈로그번호
- HPA036367-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036367-100 Anti-MTRF1L Antibody, mitochondrial translational release factor 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036367-25 Anti-MTRF1L Antibody, mitochondrial translational release factor 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTRF1L Antibody
Anti-MTRF1L Antibody
Target: mitochondrial translational release factor 1-like (MTRF1L)
Type: Polyclonal Antibody against Human MTRF1L
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against Human MTRF1L.
Affinity purified using the PrEST antigen as affinity ligand.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial translational release factor 1-like |
| Target Gene | MTRF1L |
| Antigen Sequence | KELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000019774 (82%), Rat ENSRNOG00000018773 (80%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



