AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTPAP Antibody
상품 한눈에 보기
인간 MTPAP 단백질을 인식하는 폴리클로날 항체로, 미토콘드리아 poly(A) polymerase 연구에 적합함. Rabbit 유래 IgG 항체이며, Affinity purified 방식으로 정제됨. IHC 등 다양한 응용에 사용 가능.
- 카탈로그번호
- HPA058232-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058232-100 Anti-MTPAP Antibody, mitochondrial poly(A) polymerase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058232-25 Anti-MTPAP Antibody, mitochondrial poly(A) polymerase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTPAP Antibody
Anti-MTPAP Antibody
Target Information
- Protein: Mitochondrial poly(A) polymerase
- Gene: MTPAP
- Alternative Gene Names: FLJ10486, mtPAP, PAPD1, SPAX4
Product Description
Polyclonal Antibody against Human MTPAP
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000016578 (86%)
- Mouse ENSMUSG00000024234 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Recommended Applications | IHC (Immunohistochemistry) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.