
Atlas Antibodies Anti-MTRR Antibody
상품 한눈에 보기
Human MTRR 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. PBS/glycerol buffer에 보존되어 안정적 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTRR Antibody
Target Protein: 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against human MTRR.
Alternative Gene Names
cblE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 5-methyltetrahydrofolate-homocysteine methyltransferase reductase |
| Target Gene | MTRR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000034617): 60%
- Rat (ENSRNOG00000017826): 59%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MTSS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTSS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRF1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTRF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.