Atlas Antibodies Anti-MTPAP Antibody

상품 한눈에 보기

Human MTPAP 단백질을 인식하는 Rabbit Polyclonal Antibody로, mitochondrial poly(A) polymerase 연구용에 적합함. 높은 종간 반응성(인간, 랫, 마우스) 확인. Affinity purified 방식으로 높은 특이성과 재현성 제공. PBS/glycerol buffer 보존.

카탈로그번호: HPA038620-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038620-100 Anti-MTPAP Antibody, mitochondrial poly(A) polymerase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038620-25 Anti-MTPAP Antibody, mitochondrial poly(A) polymerase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MTPAP Antibody

Anti-MTPAP Antibody

Target: mitochondrial poly(A) polymerase
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human MTPAP.

Alternative Gene Names

FLJ10486, mtPAP, PAPD1, SPAX4

Open Datasheet

Target Information

항목	내용
Target Protein	mitochondrial poly(A) polymerase
Target Gene	MTPAP
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000016578 (86%), Mouse ENSMUSG00000024234 (85%)
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS

Antibody Information

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet