Atlas Antibodies Anti-MTPAP Antibody
상품 한눈에 보기
Human MTPAP 단백질을 인식하는 Rabbit Polyclonal Antibody로, mitochondrial poly(A) polymerase 연구용에 적합함. 높은 종간 반응성(인간, 랫, 마우스) 확인. Affinity purified 방식으로 높은 특이성과 재현성 제공. PBS/glycerol buffer 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTPAP Antibody
Target: mitochondrial poly(A) polymerase
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against Human MTPAP.
Alternative Gene Names
FLJ10486, mtPAP, PAPD1, SPAX4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial poly(A) polymerase |
| Target Gene | MTPAP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016578 (86%), Mouse ENSMUSG00000024234 (85%) |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.