
Atlas Antibodies Anti-MTPN Antibody
상품 한눈에 보기
Human MTPN 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며 Human, Mouse, Rat에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTPN Antibody
Target: Myotrophin (MTPN)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human MTPN (Myotrophin).
Alternative Gene Names
GCDP, MYOTROPHIN, V-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Myotrophin |
| Target Gene | MTPN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (Amino Acid) | NGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ |
Species Reactivity
| Verified Species | Human, Mouse, Rat |
|---|---|
| Interspecies Identity | Rat ENSRNOG00000011857 (99%) Mouse ENSMUSG00000029840 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
