Atlas Antibodies Anti-MTG1 Antibody

상품 한눈에 보기

인간 MTG1 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 연구 응용에 적합하며, PBS와 글리세롤 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037827-100 Anti-MTG1 Antibody, mitochondrial ribosome-associated GTPase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037827-25 Anti-MTG1 Antibody, mitochondrial ribosome-associated GTPase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosome-associated GTPase 1
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Polyclonal Antibody against Human MTG1

GTPBP7

Target Protein: mitochondrial ribosome-associated GTPase 1
Target Gene: MTG1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
QHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKH
```

Human

Species	Ortholog ID	Identity
Rat	ENSRNOG00000018860	91%
Mouse	ENSMUSG00000039018	91%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand