
Atlas Antibodies Anti-MTG1 Antibody
상품 한눈에 보기
인간 MTG1 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 연구 응용에 적합하며, PBS와 글리세롤 버퍼에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTG1 Antibody
Target: mitochondrial ribosome-associated GTPase 1
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human MTG1
Alternative Gene Names
GTPBP7
Target Information
- Target Protein: mitochondrial ribosome-associated GTPase 1
- Target Gene: MTG1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKH
Verified Species Reactivity
Human
Interspecies Information
| Species | Ortholog ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000018860 | 91% |
| Mouse | ENSMUSG00000039018 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적 농도 및 조건은 사용자가 실험 목적에 맞게 설정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.