
Atlas Antibodies Anti-MTHFD1L Antibody
상품 한눈에 보기
사람 MTHFD1L 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대해 검증되었으며, 글리세롤 기반 완충액에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTHFD1L Antibody
Target: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human MTHFD1L.
Alternative Gene Names
DKFZP586G1517, FLJ21145, FTHFSDC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like |
| Target Gene | MTHFD1L |
| Antigen Sequence | ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019582 (84%), Mouse ENSMUSG00000040675 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MTHFD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTG1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.