CacheBy
Atlas Antibodies Anti-MTHFD1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MTHFD1L Antibody

상품 한눈에 보기

사람 MTHFD1L 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대해 검증되었으며, 글리세롤 기반 완충액에 보존되어 있습니다.

카탈로그번호
HPA029041-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029041-100 Anti-MTHFD1L Antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029041-25 Anti-MTHFD1L Antibody, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MTHFD1L Antibody

Anti-MTHFD1L Antibody

Target: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human MTHFD1L.


Alternative Gene Names

DKFZP586G1517, FLJ21145, FTHFSDC1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Target Gene MTHFD1L
Antigen Sequence ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQ
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019582 (84%), Mouse ENSMUSG00000040675 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Validation Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.