
Atlas Antibodies Anti-MTHFD1L Antibody
상품 한눈에 보기
인체 MTHFD1L 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB 실험에 적합하며, 독립 항체 간 비교 검증으로 신뢰성 향상. 토끼 유래 IgG, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTHFD1L Antibody
Target: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human MTHFD1L.
Alternative Gene Names
DKFZP586G1517, FLJ21145, FTHFSDC1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like |
| Target Gene | MTHFD1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019582 (84%), Mouse ENSMUSG00000040675 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
ARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MTHFD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.