Atlas Antibodies Anti-MST1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA024036-100 | - | Atlas Antibodies HPA024036-100 Anti-MST1 Antibody, macrophage stimulating 1 (hepatocyte growth factor-like) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA024036-25 | - | Atlas Antibodies HPA024036-25 Anti-MST1 Antibody, macrophage stimulating 1 (hepatocyte growth factor-like) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-MST1 Antibody
macrophage stimulating 1 (hepatocyte growth factor-like)
Recommended Applications
Product Description
Polyclonal Antibody against Human MST1
Alternative Gene Names
D3F15S2, DNF15S2, HGFL, MSP, NF15S2
Target Protein
macrophage stimulating 1 (hepatocyte growth factor-like)
Target Gene
MST1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000019680 (83%)
Mouse ENSMUSG00000032591 (80%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|