
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MSR1 Antibody
상품 한눈에 보기
Human MSR1을 타깃으로 하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. CD204/SCARA1 대체명 사용 가능. Affinity purified 방식으로 높은 특이성과 재현성 제공. 인체 조직 연구 및 면역분석에 적합.
- 카탈로그번호
- HPA000272-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000272-100 Anti-MSR1 Antibody, macrophage scavenger receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000272-25 Anti-MSR1 Antibody, macrophage scavenger receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MSR1 Antibody
Anti-MSR1 Antibody
macrophage scavenger receptor 1
Recommended Applications
IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MSR1
Alternative Gene Names
CD204, SCARA1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | macrophage scavenger receptor 1 |
| Target Gene | MSR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000025044 (60%), Rat ENSRNOG00000012779 (59%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



