Atlas Antibodies Anti-MSN Antibody

상품 한눈에 보기

Human MSN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation을 통해 단백질 발현을 검증하였습니다. 고순도 Affinity Purification 방식으로 제조되었습니다.

카탈로그번호: HPA011227-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011227-100 Anti-MSN Antibody, moesin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011227-25 Anti-MSN Antibody, moesin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MSN Antibody

Anti-MSN Antibody (Atlas Antibodies)

Target Information

Target Protein: Moesin
Target Gene: MSN

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry): Suitable for cellular localization studies.

Product Description

Polyclonal Antibody against Human MSN.
This antibody has been validated through orthogonal methods comparing protein and RNA expression patterns.

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT

Species Reactivity

Verified Reactivity: Human, Mouse, Rat
Interspecies Identity:
- Mouse ENSMUSG00000031207 (98%)
- Rat ENSRNOG00000030118 (97%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet