
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MSN Antibody
상품 한눈에 보기
Human MSN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation을 통해 단백질 발현을 검증하였습니다. 고순도 Affinity Purification 방식으로 제조되었습니다.
- 카탈로그번호
- HPA011227-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA011227-100 Anti-MSN Antibody, moesin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011227-25 Anti-MSN Antibody, moesin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MSN Antibody
Anti-MSN Antibody (Atlas Antibodies)
Target Information
- Target Protein: Moesin
- Target Gene: MSN
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry): Suitable for cellular localization studies.
Product Description
Polyclonal Antibody against Human MSN.
This antibody has been validated through orthogonal methods comparing protein and RNA expression patterns.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT
Species Reactivity
- Verified Reactivity: Human, Mouse, Rat
- Interspecies Identity:
- Mouse ENSMUSG00000031207 (98%)
- Rat ENSRNOG00000030118 (97%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



