Atlas Antibodies Anti-MSH6 Antibody
상품 한눈에 보기
인간 MSH6 단백질을 표적으로 하는 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 비교를 통한 단백질 발현 검증이 가능하며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MSH6 Antibody
Target Protein: mutS homolog 6
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC
Validation performed by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human MSH6.
Alternative Gene Names
GTBP
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | mutS homolog 6 |
| Target Gene | MSH6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000016134 (95%), Mouse ENSMUSG00000005370 (92%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence:
MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Document
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.