CacheBy
Atlas Antibodies Anti-MSI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSI1 Antibody

상품 한눈에 보기

휴먼 MSI1 단백질을 인식하는 폴리클로날 항체로, Musashi RNA-binding protein 1을 타깃으로 함. Rabbit 호스트에서 생산되었으며, IgG 동형. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합.

카탈로그번호
HPA074923-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074923-100 Anti-MSI1 Antibody, musashi RNA binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074923-25 Anti-MSI1 Antibody, musashi RNA binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSI1 Antibody

Anti-MSI1 Antibody

Target Information

  • Target Protein: Musashi RNA-binding protein 1
  • Target Gene: MSI1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000001156 100%
Mouse ENSMUSG00000054256 98%

Product Description

Polyclonal antibody against Human MSI1.

Open Datasheet (PDF)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

  • ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.