CacheBy
Atlas Antibodies Anti-MSL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSL2 Antibody

상품 한눈에 보기

인간 MSL2 단백질을 인식하는 폴리클로날 항체로 IHC 및 WB에 적합합니다. 토끼 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 보존성을 보여 쥐와 생쥐에서도 98% 동일성을 가집니다. PBS 및 글리세롤 완충액에 보존제 포함.

카탈로그번호
HPA003413-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003413-100 Anti-MSL2 Antibody, male-specific lethal 2 homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003413-25 Anti-MSL2 Antibody, male-specific lethal 2 homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSL2 Antibody

Anti-MSL2 Antibody

Target: male-specific lethal 2 homolog (Drosophila)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human MSL2.


Alternative Gene Names

FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184

Open Datasheet


Target Information

항목 내용
Target Protein male-specific lethal 2 homolog (Drosophila)
Target Gene MSL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000023021 (98%), Mouse ENSMUSG00000066415 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 함량 및 조건
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)
MSDS Material Safety Data Sheet

Antigen Sequence

SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.