
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS18B Antibody
상품 한눈에 보기
Human MRPS18B 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공하며, 40% glycerol 기반 PBS buffer에 보존되어 안정적입니다.
- 카탈로그번호
- HPA050334-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050334-100 Anti-MRPS18B Antibody, mitochondrial ribosomal protein S18B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050334-25 Anti-MRPS18B Antibody, mitochondrial ribosomal protein S18B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS18B Antibody
Anti-MRPS18B Antibody
Target Information
- Target Protein: mitochondrial ribosomal protein S18B
- Target Gene: MRPS18B
- Alternative Gene Names: C6orf14, HSPC183, MRPS18-2, PTD017
Product Description
Polyclonal Antibody against Human MRPS18B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024436 | 82% |
| Rat | ENSRNOG00000000804 | 80% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resource
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



