CacheBy
Atlas Antibodies Anti-MRPS24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS24 Antibody

상품 한눈에 보기

Human MRPS24 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간과 설치류에서 반응성이 검증되었습니다. 미토콘드리아 리보솜 단백질 연구에 유용합니다.

카탈로그번호
HPA073947-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073947-100 Anti-MRPS24 Antibody, mitochondrial ribosomal protein S24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073947-25 Anti-MRPS24 Antibody, mitochondrial ribosomal protein S24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS24 Antibody

Anti-MRPS24 Antibody

Target Information

  • Target Protein: Mitochondrial ribosomal protein S24
  • Target Gene: MRPS24
  • Alternative Gene Names: HSPC335, MRP-S24

Product Description

Polyclonal antibody against human MRPS24.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY

Verified Species Reactivity

  • Human
  • Rat

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000011979 (87%)
  • Mouse ENSMUSG00000020477 (87%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 조건은 사용자가 결정해야 합니다.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.