Atlas Antibodies Anti-MRPS18C Antibody

상품 한눈에 보기

인간 MRPS18C 단백질을 대상으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응성이 검증됨. PBS와 글리세롤 버퍼에 보존제로 sodium azide 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050404-100 Anti-MRPS18C Antibody, mitochondrial ribosomal protein S18C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050404-25 Anti-MRPS18C Antibody, mitochondrial ribosomal protein S18C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosomal protein S18C
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Polyclonal antibody against Human MRPS18C.

CGI-134, FLJ11146, FLJ22967, MRPS18-1

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR

Human

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000002178	94%
Mouse	ENSMUSG00000016833	93%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.