Thermo Fisher Scientific RFPL2 Polyclonal Antibody
Thermo Fisher Scientific RFPL2 Polyclonal Antibody는 인간 및 랫트 시료에서 RFPL2 단백질 검출에 적합합니다. Western blot과 ELISA에 사용 가능하며, 고순도의 rabbit IgG 폴리클로날 항체입니다. 액상 형태로 제공되며, PBS/glycerol buffer에 보관됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1:500–1:2,000
ELISA
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to amino acids 50–150 of human RFPL2 (NP_006596.2) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.74 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2805851 |
Product Specific Information
- Immunogen sequence: PMSLECGCAVCLKCINSLQKEPHGEDLLCCCSSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDANTANNFLLISDDLRSVRSG
- Positive Samples: U-87MG, 22RV1, 293T, LO2, Rat brain, Rat testis
Target Information
RFPL1, RFPL2, and RFPL3 (ret finger protein-like 1, 2, and 3) form a gene cluster on human chromosome 22q12.2–q13.3, sharing 95–96% identity. These genes are implicated in neocortex organization and size in primates, showing high expression in fetal neocortex and embryonic stem-cell neurogenesis. RFPL2 (RNF79) is 378 amino acids long, highly expressed in prostate, and less expressed in fetal kidney and liver. Two isoforms of RFPL2 exist due to alternative splicing.
주의사항
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific DNAJB12 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific DRD3 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific RFPL2 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CYP2B6 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ESRP1 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|