CacheBy
Atlas Antibodies Anti-ASB13 Antibody
원본

Atlas Antibodies Anti-ASB13 Antibody

상품 한눈에 보기

Human ASB13 단백질을 표적으로 하는 폴리클로날 토끼 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성 보유. 40% 글리세롤 및 PBS 버퍼로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061742-100 Anti-ASB13 Antibody, ankyrin repeat and SOCS box containing 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061742-25 Anti-ASB13 Antibody, ankyrin repeat and SOCS box containing 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASB13 Antibody

Anti-ASB13 Antibody

Target: ankyrin repeat and SOCS box containing 13 (ASB13)
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ASB13.

Alternative Gene Names

  • FLJ13134
  • MGC19879

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ankyrin repeat and SOCS box containing 13
Target Gene ASB13
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (96%)

Antigen Information

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.