AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ASB16 Antibody
상품 한눈에 보기
인간 ASB16 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 높은 종 간 서열 유사성을 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066834-100 Anti-ASB16 Antibody, ankyrin repeat and SOCS box containing 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066834-25 Anti-ASB16 Antibody, ankyrin repeat and SOCS box containing 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ASB16 Antibody
Anti-ASB16 Antibody
Target: ankyrin repeat and SOCS box containing 16 (ASB16)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ASB16.
Alternative Gene Names
- FLJ30165
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ankyrin repeat and SOCS box containing 16 |
| Target Gene | ASB16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000034768 | 91% |
| Rat | ENSRNOG00000036794 | 87% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.