Atlas Antibodies Anti-ASAH1 Antibody

상품 한눈에 보기

인간 ASAH1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. 정제된 PrEST 항원 기반으로 제작되어 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 항체로, PBS와 글리세롤 용액에 보존되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005468-100 Anti-ASAH1 Antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005468-25 Anti-ASAH1 Antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ASAH1 Antibody

Anti-ASAH1 Antibody

N-acylsphingosine amidohydrolase (acid ceramidase) 1

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)

Orthogonal validation: Protein expression verified using WB by comparison to RNA-seq data of the corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human ASAH1

Alternative Gene Names

AC, ASAH, FLJ21558, PHP32

Open Datasheet

Target Information

항목	내용
Target Protein	N-acylsphingosine amidohydrolase (acid ceramidase) 1
Target Gene	ASAH1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000010034 (86%), Mouse ENSMUSG00000031591 (82%)

Antigen Sequence (Amino Acid):
ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF