Thermo Fisher Scientific UBA3 Polyclonal Antibody
UBA3 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF, Flow Cytometry에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로 사용되며 단백질 유비퀴틴화 관련 연구에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409–448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747314 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin-protein ligases (E3s).
This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and the enzyme complex activates NEDD8, a ubiquitin-like protein that regulates cell division, signaling, and embryogenesis.
Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-80200_UBA3_Q8TBC4-1_Rabbit.svg, PA5-80200_UBA3_Q8TBC4-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific UBD Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Transthyretin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UBA3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UBA2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TSLP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|