CacheBy
Thermo Fisher Scientific MEFV Polyclonal Antibody
원본

Thermo Fisher Scientific MEFV Polyclonal Antibody

상품 한눈에 보기

MEFV 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 최적화되어 있으며 인간과 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오전 10:19
Thermo Fisher Scientific PA579662 MEFV Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MEFV Polyclonal Antibody

Applications

  • Western Blot (WB)

Tested Dilution

  • 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV (5–39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746777

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity.
Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.

For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.