Thermo Fisher Scientific MEFV Polyclonal Antibody
MEFV 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 최적화되어 있으며 인간과 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB)
Tested Dilution
- 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV (5–39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746777 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity.
Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MED18 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MED9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MEFV Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PCQAP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MED14 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|