원본
Thermo Fisher Scientific MEFV Polyclonal Antibody
상품 한눈에 보기
MEFV 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 최적화되어 있으며 인간과 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오전 10:19
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579662 MEFV Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MEFV Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution
- 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV (5–39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746777 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity.
Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MED18 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MED9 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PCQAP Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific MED14 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.