Atlas Antibodies Anti-MRPL10 Antibody

상품 한눈에 보기

인간 MRPL10 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 검증된 반응성과 독립 항체 비교를 통한 검증 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029885-100 Anti-MRPL10 Antibody, mitochondrial ribosomal protein L10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029885-25 Anti-MRPL10 Antibody, mitochondrial ribosomal protein L10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosomal protein L10
Type: Polyclonal Antibody against Human MRPL10
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody raised in rabbit against human MRPL10.

L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8

항목	내용
Target Protein	mitochondrial ribosomal protein L10
Target Gene	MRPL10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000009567 (91%), Mouse ENSMUSG00000001445 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Determine optimal concentrations and conditions for each application.