
Atlas Antibodies Anti-MRPL10 Antibody
상품 한눈에 보기
인간 MRPL10 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 검증된 반응성과 독립 항체 비교를 통한 검증 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL10 Antibody
Target: mitochondrial ribosomal protein L10
Type: Polyclonal Antibody against Human MRPL10
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independent antibody validation)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human MRPL10.
Alternative Gene Names
L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L10 |
| Target Gene | MRPL10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000009567 (91%), Mouse ENSMUSG00000001445 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Determine optimal concentrations and conditions for each application. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL12 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.