
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL12 Antibody
상품 한눈에 보기
Human MRPL12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. 미토콘드리아 리보솜 단백질 L12 검출용. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA023043-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023043-100 Anti-MRPL12 Antibody, mitochondrial ribosomal protein L12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023043-25 Anti-MRPL12 Antibody, mitochondrial ribosomal protein L12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL12 Antibody
Anti-MRPL12 Antibody
Target: mitochondrial ribosomal protein L12 (MRPL12)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MRPL12, a mitochondrial ribosomal protein L12.
Alternative Gene Names
MRPL7, MRPL7/L12, RPML12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L12 |
| Target Gene | MRPL12 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (86%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



