
Atlas Antibodies Anti-MRPL12 Antibody
Human MRPL12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. 미토콘드리아 리보솜 단백질 L12 검출용. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL12 Antibody
Target: mitochondrial ribosomal protein L12 (MRPL12)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MRPL12, a mitochondrial ribosomal protein L12.
Alternative Gene Names
MRPL7, MRPL7/L12, RPML12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L12 |
| Target Gene | MRPL12 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (86%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MROH8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|