AI 생성

1 / 2

Atlas Antibodies Anti-MRPL11 Antibody

상품 한눈에 보기

인간 MRPL11 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼 포함, 안정적인 보존 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057685-100 Anti-MRPL11 Antibody, mitochondrial ribosomal protein L11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057685-25 Anti-MRPL11 Antibody, mitochondrial ribosomal protein L11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosomal protein L11 (MRPL11)
Supplier: Atlas Antibodies

Polyclonal antibody against Human MRPL11

항목	내용
Target Protein	mitochondrial ribosomal protein L11
Target Gene	MRPL11
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000019970 (91%), Mouse ENSMUSG00000024902 (90%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.