
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MPV17L2 Antibody
상품 한눈에 보기
Human MPV17L2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증 완료. 고순도 Affinity 정제 항체로 안정한 PBS/glycerol buffer에 보존됩니다.
- 카탈로그번호
- HPA043111-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043111-100 Anti-MPV17L2 Antibody, MPV17 mitochondrial membrane protein-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043111-25 Anti-MPV17L2 Antibody, MPV17 mitochondrial membrane protein-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MPV17L2 Antibody
Anti-MPV17L2 Antibody
Target: MPV17 mitochondrial membrane protein-like 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human MPV17L2.
Alternative Gene Names
FKSG24, MGC12972
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | MPV17 mitochondrial membrane protein-like 2 |
| Target Gene | MPV17L2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD |
Species Reactivity
| Verified Species | Reactivity |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000019394 (74%)
- Mouse ENSMUSG00000111476 (74%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



