
Atlas Antibodies Anti-MPV17L2 Antibody
Human MPV17L2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증 완료. 고순도 Affinity 정제 항체로 안정한 PBS/glycerol buffer에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MPV17L2 Antibody
Target: MPV17 mitochondrial membrane protein-like 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human MPV17L2.
Alternative Gene Names
FKSG24, MGC12972
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | MPV17 mitochondrial membrane protein-like 2 |
| Target Gene | MPV17L2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD |
Species Reactivity
| Verified Species | Reactivity |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000019394 (74%)
- Mouse ENSMUSG00000111476 (74%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MPZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPZL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPV17L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|