
Atlas Antibodies Anti-MPRIP Antibody
Human MPRIP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 검증을 통해 단백질 발현을 확인함. PrEST 항원을 이용해 친화 정제되었으며, 다양한 연구 응용에 적합. 보존용으로 글리세롤과 PBS 완충액 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MPRIP Antibody
myosin phosphatase Rho interacting protein
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human MPRIP
Alternative Gene Names
M-RIP, p116Rip, RHOIP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myosin phosphatase Rho interacting protein |
| Target Gene | MPRIP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RVEGHVGELGDFQVKNSQALMCLENCREQLRSLPRASQEDEQDARAASLASVESALVSAIQALQHWPAPAHGGARAQLETGGTEENGKPASLQQCSQSELTEQEQVRLLSDQIALEASLISQIADSLKNTT |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000003226 | 63% |
| Mouse | ENSMUSG00000005417 | 62% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MPV17L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPPED2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPPE1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|