
Atlas Antibodies Anti-MPRIP Antibody
Human MPRIP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. M-RIP, p116Rip 등 대체 유전자명으로도 알려짐. 안정한 PBS/glycerol 완충액에 보존됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MPRIP Antibody
myosin phosphatase Rho interacting protein
Recommended Applications
단백질 발현 검증을 위해 서로 다른 에피토프를 타깃하는 독립 항체를 비교하여 IHC에서 검증됨.
Product Description
Polyclonal Antibody against Human MPRIP
Alternative Gene Names
M-RIP, p116Rip, RHOIP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | myosin phosphatase Rho interacting protein |
| Target Gene | MPRIP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RVEGHVGELGDFQVKNSQALMCLENCREQLRSLPRASQEDEQDARAASLASVESALVSAIQALQHWPAPAHGGARAQLETGGTEENGKPASLQQCSQSELTEQEQVRLLSDQIALEASLISQIADSLKNTT |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000003226 (63%)
- Mouse ENSMUSG00000005417 (62%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MPZL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPV17L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPPED2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|