
Atlas Antibodies Anti-METTL9 Antibody
상품 한눈에 보기
Human METTL9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western blot에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol/PBS buffer로 안정한 장기 보관 가능. DREV1 대체 유전자명으로도 알려짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-METTL9 Antibody
Target: methyltransferase like 9 (METTL9)
Type: Polyclonal Antibody against Human METTL9
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Rabbit polyclonal antibody targeting human METTL9 protein.
Alternative gene name: DREV1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000025940 (100%)
- Mouse ENSMUSG00000030876 (99%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage | Store at recommended conditions; mix gently before use |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MEX3D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MEX3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METTL9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METTL8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METTL7B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.