CacheBy
Atlas Antibodies Anti-METTL9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-METTL9 Antibody

상품 한눈에 보기

Human METTL9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western blot에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol/PBS buffer로 안정한 장기 보관 가능. DREV1 대체 유전자명으로도 알려짐.

카탈로그번호
HPA053588-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053588-100 Anti-METTL9 Antibody, methyltransferase like 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053588-25 Anti-METTL9 Antibody, methyltransferase like 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-METTL9 Antibody

Anti-METTL9 Antibody

Target: methyltransferase like 9 (METTL9)
Type: Polyclonal Antibody against Human METTL9


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit polyclonal antibody targeting human METTL9 protein.
Alternative gene name: DREV1

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000025940 (100%)
    • Mouse ENSMUSG00000030876 (99%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Store at recommended conditions; mix gently before use
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon
WB Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.