CacheBy
Atlas Antibodies Anti-METTL8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-METTL8 Antibody

상품 한눈에 보기

Human METTL8 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 Western Blot에 적합. PrEST 항원으로 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유. 안정적 PBS/glycerol buffer에 보존.

카탈로그번호
HPA035421-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035421-100 Anti-METTL8 Antibody, methyltransferase like 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035421-25 Anti-METTL8 Antibody, methyltransferase like 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-METTL8 Antibody

Anti-METTL8 Antibody

Target: methyltransferase like 8
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human METTL8


Alternative Gene Names

FLJ13984, TIP

Open Datasheet


Target Information

  • Target Protein: methyltransferase like 8
  • Target Gene: METTL8
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000041975 (83%)
  • Rat ENSRNOG00000009382 (82%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.