Atlas Antibodies Anti-METTL7B Antibody

상품 한눈에 보기

Human METTL7B 단백질을 인식하는 고품질 rabbit polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 orthogonal validation으로 신뢰성 검증. PrEST 항원 친화 정제 방식으로 높은 특이도 보장.

카탈로그번호: HPA038644-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038644-100 Anti-METTL7B Antibody, methyltransferase like 7B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038644-25 Anti-METTL7B Antibody, methyltransferase like 7B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-METTL7B Antibody

Anti-METTL7B Antibody

methyltransferase like 7B

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human METTL7B

Alternative Gene Names

ALDI, MGC17301

Open Datasheet

Target Information

항목	내용
Target Protein	methyltransferase like 7B
Target Gene	METTL7B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000025347 (83%), Rat ENSRNOG00000007927 (80%)

Antigen Sequence:
RVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAV

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand