
Thermo Fisher Scientific DGAT1 Polyclonal Antibody
DGAT1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체. Western blot에 적합하며 인간 및 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280–318aa: RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746266 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The enzyme encoded by this gene utilizes diacylglycerol and fatty acyl CoA as substrates to catalyze the final stage of triacylglycerol synthesis. It is involved in cellular and physiological metabolic processes.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific DLD Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific DKK2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific DGAT1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SAP102 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RIG-I Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|