CacheBy
Thermo Fisher Scientific DGAT1 Polyclonal Antibody
원본

Thermo Fisher Scientific DGAT1 Polyclonal Antibody

상품 한눈에 보기

DGAT1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체. Western blot에 적합하며 인간 및 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오후 08:44
Thermo Fisher Scientific PA579150 DGAT1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific DGAT1 Polyclonal Antibody

Applications

Product Specifications

항목 내용
Species Reactivity Human, Rat
Published Species Not Applicable
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280–318aa: RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746266

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The enzyme encoded by this gene utilizes diacylglycerol and fatty acyl CoA as substrates to catalyze the final stage of triacylglycerol synthesis. It is involved in cellular and physiological metabolic processes.


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.