
원본
Thermo Fisher Scientific DGAT1 Polyclonal Antibody
상품 한눈에 보기
DGAT1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체. Western blot에 적합하며 인간 및 랫트 시료에 반응. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오후 08:44
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579150 DGAT1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific DGAT1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280–318aa: RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746266 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The enzyme encoded by this gene utilizes diacylglycerol and fatty acyl CoA as substrates to catalyze the final stage of triacylglycerol synthesis. It is involved in cellular and physiological metabolic processes.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
