
Atlas Antibodies Anti-MED14 Antibody
상품 한눈에 보기
Human MED14 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며, 40% glycerol 기반 안정화 buffer 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MED14 Antibody
Target Information
- Target Protein: Mediator complex subunit 14
- Target Gene: MED14
- Alternative Gene Names: CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170
Product Description
Polyclonal antibody against Human MED14.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Species Reactivity
- Verified Species: Human
- Ortholog Sequence Identity:
- Mouse (ENSMUSG00000064127): 100%
- Rat (ENSRNOG00000003792): 100%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| MSDS | Material Safety Data Sheet |
Recommended Applications
ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MED21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MED19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MED14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MED17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MED15 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.