CacheBy
Atlas Antibodies Anti-MED15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED15 Antibody

상품 한눈에 보기

Human MED15 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 ICC 등 다양한 응용 가능. PrEST 항원을 이용한 친화 정제 방식. 높은 종간 서열 동일성(인간, 생쥐, 랫드). 안정적 PBS/glycerol buffer 보존.

카탈로그번호
HPA003179-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003179-100 Anti-MED15 Antibody, mediator complex subunit 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003179-25 Anti-MED15 Antibody, mediator complex subunit 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED15 Antibody

Anti-MED15 Antibody

Target: Mediator complex subunit 15 (MED15)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MED15.


Alternative Gene Names

Arc105, CAG7A, PCQAP, TIG-1, TNRC7

Open Datasheet


Target Information

항목 내용
Target Protein Mediator complex subunit 15
Target Gene MED15
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (96%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.