CacheBy
Atlas Antibodies Anti-MCM8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCM8 Antibody

상품 한눈에 보기

Human MCM8 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 응용에 적합. Rabbit 유래 IgG 형태이며 PrEST 항원으로 정제됨. 높은 종간 서열 동일성으로 인간, 마우스, 랫트에 반응. 실험 전 부드럽게 혼합 필요.

카탈로그번호
HPA045141-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045141-100 Anti-MCM8 Antibody, minichromosome maintenance 8 homologous recombination repair factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045141-25 Anti-MCM8 Antibody, minichromosome maintenance 8 homologous recombination repair factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCM8 Antibody

Anti-MCM8 Antibody

Target Protein: minichromosome maintenance 8 homologous recombination repair factor
Product Type: Polyclonal Antibody against Human MCM8

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Alternative Gene Names

C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC

Open Datasheet

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

ERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027353 88%
Rat ENSRNOG00000021272 87%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Base PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.