
원본
Atlas Antibodies Anti-MAVS Antibody
상품 한눈에 보기
인간 MAVS 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. 독립 항체 간 비교 검증 완료. 토끼 유래 IgG 형태로 PrEST 항원을 이용해 친화 정제됨. 다양한 연구용 응용에 활용 가능.
- 카탈로그번호
- HPA053524-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053524-100 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053524-25 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAVS Antibody
Anti-MAVS Antibody
Mitochondrial Antiviral Signaling Protein
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human MAVS.
Alternative Gene Names
Cardif, IPS-1, KIAA1271, VISA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitochondrial antiviral signaling protein |
| Target Gene | MAVS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Rat | ENSRNOG00000025295 | 46% |
| Mouse | ENSMUSG00000037523 | 41% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



