CacheBy
Atlas Antibodies Anti-MAVS Antibody
원본

Atlas Antibodies Anti-MAVS Antibody

상품 한눈에 보기

인간 MAVS 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. 독립 항체 간 비교 검증 완료. 토끼 유래 IgG 형태로 PrEST 항원을 이용해 친화 정제됨. 다양한 연구용 응용에 활용 가능.

카탈로그번호
HPA053524-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053524-100 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053524-25 Anti-MAVS Antibody, mitochondrial antiviral signaling protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAVS Antibody

Anti-MAVS Antibody

Mitochondrial Antiviral Signaling Protein


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human MAVS.


Alternative Gene Names

Cardif, IPS-1, KIAA1271, VISA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Mitochondrial antiviral signaling protein
Target Gene MAVS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV

Verified Species Reactivity

Human


Interspecies Information

유전자 ID 항원 서열 동일성
Rat ENSRNOG00000025295 46%
Mouse ENSMUSG00000037523 41%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.