CacheBy
Atlas Antibodies Anti-MAU2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAU2 Antibody

상품 한눈에 보기

Human MAU2 단백질을 타깃으로 한 토끼 폴리클로날 항체로, 세포 응집 인자 연구에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat에 반응. 40% glycerol 기반 버퍼에 보존제 포함.

카탈로그번호
HPA059897-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059897-100 Anti-MAU2 Antibody, MAU2 sister chromatid cohesion factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059897-25 Anti-MAU2 Antibody, MAU2 sister chromatid cohesion factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAU2 Antibody

Anti-MAU2 Antibody

Target Information

  • Target Protein: MAU2 sister chromatid cohesion factor
  • Target Gene: MAU2
  • Alternative Gene Names: KIAA0892, mau-2, MAU2L, MGC75361, SCC4

Product Description

Polyclonal antibody against human MAU2, designed for research applications related to sister chromatid cohesion factor studies.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000031858): 100%
  • Rat (ENSRNOG00000020526): 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Preservative Sodium azide (0.02%)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Information

Open Datasheet

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.