
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAT2B Antibody
상품 한눈에 보기
Human MAT2B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 발현 기반 검증으로 높은 특이성과 신뢰성 제공. PrEST 항원을 이용한 친화 정제 방식으로 제조됨. Human, Mouse, Rat에서 반응 확인됨.
- 카탈로그번호
- HPA037722-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037722-100 Anti-MAT2B Antibody, methionine adenosyltransferase II, beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037722-25 Anti-MAT2B Antibody, methionine adenosyltransferase II, beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAT2B Antibody
Anti-MAT2B Antibody
Target: methionine adenosyltransferase II, beta (MAT2B)
Type: Polyclonal Antibody against Human MAT2B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against Human MAT2B.
Alternative Gene Names
MATIIbeta, SDR23E1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methionine adenosyltransferase II, beta |
| Target Gene | MAT2B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM |
| Verified Species Reactivity | Human |
| Orthologs (Identity) | Mouse ENSMUSG00000042032 (95%), Rat ENSRNOG00000003177 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



