
Atlas Antibodies Anti-MAT2B Antibody
상품 한눈에 보기
Human MAT2B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 발현 기반 검증으로 높은 특이성과 신뢰성 제공. PrEST 항원을 이용한 친화 정제 방식으로 제조됨. Human, Mouse, Rat에서 반응 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAT2B Antibody
Target: methionine adenosyltransferase II, beta (MAT2B)
Type: Polyclonal Antibody against Human MAT2B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against Human MAT2B.
Alternative Gene Names
MATIIbeta, SDR23E1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methionine adenosyltransferase II, beta |
| Target Gene | MAT2B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM |
| Verified Species Reactivity | Human |
| Orthologs (Identity) | Mouse ENSMUSG00000042032 (95%), Rat ENSRNOG00000003177 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MASTL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MASTL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAT2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAST3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAST4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.