AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MASTL Antibody
상품 한눈에 보기
Human MASTL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 단백질 기반으로 검증되어 높은 특이성과 신뢰성을 제공. PrEST 항원 친화 정제 방식으로 제조되어 재현성 우수.
- 카탈로그번호
- HPA027175-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027175-100 Anti-MASTL Antibody, microtubule associated serine/threonine kinase-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027175-25 Anti-MASTL Antibody, microtubule associated serine/threonine kinase-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MASTL Antibody
Anti-MASTL Antibody
microtubule associated serine/threonine kinase-like
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human MASTL
Alternative Gene Names
FLJ14813, THC2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule associated serine/threonine kinase-like |
| Target Gene | MASTL |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQNDCANKEN |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000054474 (64%), Mouse ENSMUSG00000026779 (62%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.