CacheBy
Atlas Antibodies Anti-MAS1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAS1L Antibody

상품 한눈에 보기

인간 MAS1L 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 보존용으로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA017983-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017983-100 Anti-MAS1L Antibody, MAS1 proto-oncogene like, G protein-coupled receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017983-25 Anti-MAS1L Antibody, MAS1 proto-oncogene like, G protein-coupled receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAS1L Antibody

Anti-MAS1L Antibody

MAS1 proto-oncogene like, G protein-coupled receptor


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MAS1L.


Alternative Gene Names

dJ994E9.2, MAS-L, MRG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein MAS1 proto-oncogene like, G protein-coupled receptor
Target Gene MAS1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000009551 (25%), Rat ENSRNOG00000027552 (23%)

Antigen Sequence:

ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.